Protein Info for CA265_RS07920 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aminotransferase DegT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 PF01041: DegT_DnrJ_EryC1" amino acids 12 to 353 (342 residues), 322.1 bits, see alignment E=7.8e-100 PF01212: Beta_elim_lyase" amino acids 33 to 264 (232 residues), 45.9 bits, see alignment E=7.3e-16 PF00266: Aminotran_5" amino acids 37 to 157 (121 residues), 22.2 bits, see alignment E=9.9e-09

Best Hits

KEGG orthology group: None (inferred from 68% identity to psn:Pedsa_0815)

Predicted SEED Role

"UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase (EC 2.6.1.-)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) (EC 2.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.-

Use Curated BLAST to search for 2.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2X4 at UniProt or InterPro

Protein Sequence (385 amino acids)

>CA265_RS07920 aminotransferase DegT (Pedobacter sp. GW460-11-11-14-LB5)
MIPVTKPFLPKQAEFKSYVSSIWARQWLTNNGPLVNELELKLQQYLGLPHLLYVTNGTIA
LQLAIQALEVKGEIITTPFSFVATTSSIVWQGCKPVFVDIDEDTLNIDPNKIEAAITPDT
SAILATHVFGNPCDVEAIDRIAKKHGLKVIYDAAHCFGTKYKGKSIFAYGDVSTTSFHAT
KLFHTIEGGAVFTQNPEILKRMALMRNFGYSGVDTFSEIGTNAKNSEFHAAMGLCNLKHI
DQILSKRKELSQHYEMRLNKIEAQFQIIQADTDFNYAYYPVIFRSEEVMLDCMKELELVQ
VYCRRYFYPSLSALPYIDKVNMPICDSISKRIMCLPLYHTLTSADQDLVVRIILRTQNYR
KKQVLKLADYGKLVNGSIGMVVNGN