Protein Info for CA265_RS07865 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aquaporin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details PF00230: MIP" amino acids 4 to 240 (237 residues), 156.5 bits, see alignment E=4.5e-50 TIGR00861: MIP family channel proteins" amino acids 6 to 240 (235 residues), 175.1 bits, see alignment E=9.3e-56

Best Hits

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 70% identity to phe:Phep_4188)

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z381 at UniProt or InterPro

Protein Sequence (246 amino acids)

>CA265_RS07865 aquaporin (Pedobacter sp. GW460-11-11-14-LB5)
MNVYLAEFIGTALMILLGNGVVANVVLKGTKGNNSGWIVITTAWALAVFVGVVVAGPYSG
AHLNPIVTLGLAIGKGFSWALAPFYIIAQLAGAMTGSFLVWLIYKDHFDATDDQGLKAAP
FATAPAIRNISSNLLSEIIGTFVLIFVIFYFTDASMGTKETVTTPIGLGSMGAIPVAFLV
WVIGLALGGTTGYAINPARDLGPRIIHFLIPMKGKGGSDWSYAWVPIVGPIIGSVLAAVA
FLLISK