Protein Info for CA265_RS07750 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: aminoacetone oxidase family FAD-binding enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00890: FAD_binding_2" amino acids 4 to 52 (49 residues), 32.7 bits, see alignment 1.5e-11 PF07992: Pyr_redox_2" amino acids 4 to 168 (165 residues), 28.5 bits, see alignment E=3.1e-10 PF03486: HI0933_like" amino acids 4 to 394 (391 residues), 409.7 bits, see alignment E=3.6e-126 TIGR00275: flavoprotein, HI0933 family" amino acids 6 to 394 (389 residues), 371.5 bits, see alignment E=2.4e-115 PF13450: NAD_binding_8" amino acids 7 to 40 (34 residues), 22.3 bits, see alignment 4e-08

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 76% identity to phe:Phep_1899)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z316 at UniProt or InterPro

Protein Sequence (396 amino acids)

>CA265_RS07750 aminoacetone oxidase family FAD-binding enzyme (Pedobacter sp. GW460-11-11-14-LB5)
MNADAIIIGAGACGLMCAVQAGYLGKKVIVLEKNEKPGAKILISGGGRCNYTNQFASAEH
FISANPHFIKSAFTQWTVDDTISFFETYGITGKEKTLGQLFPDDKNAKDVVEVFTSICED
FGQEIRCNADVKGIEILPEGFKVSYEKNGKTIVLTAEKLVITTGGLPIPKMGATDFALRF
ARKHHLKIIETAPALVPLTITGKDEEWFAQLSGNSVFCEVSNDEISFEENILFTHWGLSG
PAILQISSFWRRGETINLNLLPHQNVLTLLDEERKNNGKTLLSTLLNRIYTKKFTDALGK
FLPLSKPVAALTKAEIDLIEQTVHHFKVKPAGDKGYDKAEVMRGGIDTNEISSKTLECKK
IPNLFFGGECLDVTGWLGGYNFQWAWASGFVIAQNI