Protein Info for CA265_RS07665 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 482 transmembrane" amino acids 455 to 472 (18 residues), see Phobius details PF01370: Epimerase" amino acids 3 to 96 (94 residues), 39.9 bits, see alignment E=8.4e-14 PF05368: NmrA" amino acids 3 to 150 (148 residues), 31.7 bits, see alignment E=2.7e-11 PF13460: NAD_binding_10" amino acids 7 to 148 (142 residues), 48.4 bits, see alignment E=2.6e-16 PF11066: DUF2867" amino acids 334 to 471 (138 residues), 98 bits, see alignment E=1.6e-31

Best Hits

KEGG orthology group: None (inferred from 57% identity to mtt:Ftrac_1418)

Predicted SEED Role

"Putative nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z3N7 at UniProt or InterPro

Protein Sequence (482 amino acids)

>CA265_RS07665 epimerase (Pedobacter sp. GW460-11-11-14-LB5)
MKILLTGANGYIGTRLLPLLLEEKHEIVCMVRDKRRFISESDLSDQVKIITGDLLNAESL
NEIPKDIDAAYYLVHSMSSSQTGFSDMEKASSENFSAAISKTNCRQIIYLTGIANDEHLS
KHLGSRLAVEEELKSSGKACTILRAAIIIGSGSASFEIIRDLTEKIPFMITPKWVETRCQ
PIGIRDVLAYLLGVLQREQAFNQTFDIGGPDVLTYREMLLGYAKERGLKRWIITVPVLTP
RLSSLWLNMITPVPYSLARSLVDSMKNEVICKDHRIQEVVPRKCLSYAESLHLAFEKIDQ
NSIVSSWKDALNRGYLNSNFMDQIKVPQNGTLAYKVKMPFERKAEEVFENIWSIGGNRGW
YFMDWLWHLRGFLDKMFGGVGTRRGRTSNIDLQAGDVLDFWRVLLADRKSKRLLLYAEMK
VPGEAWLELKLVEFHGKAFLSQIATFRPKGLWGRIYWYAMWPFHIILFKGMAREITTYKP
NN