Protein Info for CA265_RS07345 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR03351: phosphonatase-like hydrolase" amino acids 1 to 219 (219 residues), 230.4 bits, see alignment E=3.7e-72 PF13419: HAD_2" amino acids 2 to 184 (183 residues), 76.7 bits, see alignment E=3.9e-25 PF00702: Hydrolase" amino acids 2 to 183 (182 residues), 68.7 bits, see alignment E=1.4e-22 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 129 to 183 (55 residues), 24.2 bits, see alignment E=5.9e-09 PF13242: Hydrolase_like" amino acids 145 to 214 (70 residues), 36.9 bits, see alignment E=4.3e-13

Best Hits

KEGG orthology group: None (inferred from 60% identity to cpi:Cpin_4840)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZCG9 at UniProt or InterPro

Protein Sequence (223 amino acids)

>CA265_RS07345 HAD family hydrolase (Pedobacter sp. GW460-11-11-14-LB5)
MVVFDMAGTTVNENNLVYKTLMNAINAAGFSYTLDQVLAVAAGKEKKEAIRSVLKTYEGS
FDEEVVFNIYEEFIGKLKLAYETEEILPQPGSIELFEKLRQKGIISVLNTGYDRVTAEAI
LNRLGWKVGTDFDTLVTASEVGQNRPEPDMILLAMRHHGLTDGKSVVKVGDSSIDIEEGK
NAGCGLSIGITTGAHTQKQLEEAEPDAVIDNLMDILAMVTKQN