Protein Info for CA265_RS07225 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: mannonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 TIGR00695: mannonate dehydratase" amino acids 6 to 385 (380 residues), 502.7 bits, see alignment E=4e-155 PF03786: UxuA" amino acids 7 to 383 (377 residues), 396.7 bits, see alignment E=7.8e-123

Best Hits

Swiss-Prot: 56% identical to UXUA_TOLAT: Mannonate dehydratase (uxuA) from Tolumonas auensis (strain DSM 9187 / TA4)

KEGG orthology group: K01686, mannonate dehydratase [EC: 4.2.1.8] (inferred from 77% identity to phe:Phep_2262)

MetaCyc: 54% identical to D-mannonate dehydratase (Escherichia coli K-12 substr. MG1655)
Mannonate dehydratase. [EC: 4.2.1.8]

Predicted SEED Role

"Mannonate dehydratase (EC 4.2.1.8)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 4.2.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z364 at UniProt or InterPro

Protein Sequence (389 amino acids)

>CA265_RS07225 mannonate dehydratase (Pedobacter sp. GW460-11-11-14-LB5)
MKYKKLEQTWRWYGPNDPVSLQDVKQAGATGIVTALHHIPHGEVWPLTDIQERKAIIEAA
GLTWSVVESVPVHEAIKTRRADAGKYIENYKTSLRNLSACGIKIVCYNFMPVLDWTRTQL
DLEMTDGSKALYFNWIDLAIFDLYILKREGAEADYSKSILDRAEAKYSTLTEQDLADLRV
NVLMGIPNEKEIELETLRNSINEYKAIGTQGLKENLKFFLSSIAEVCTTEGIKMTIHPDD
PPYAILGLPRIASTLEDFNYIIKEVDQAFNGVCFCTGSLGAGMGNNALEIFNAVKERVYF
AHLRNVKKDEDGSFYEADHLGGDVNMYEIMKALSEENALRDKSIPFRPDHGHQMLDDLAK
VTNPGYSAIGRLRGLAELRGLEIGVTGNY