Protein Info for CA265_RS06570 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 30 to 47 (18 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 291 (19 residues), see Phobius details amino acids 326 to 345 (20 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 388 to 410 (23 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details amino acids 467 to 485 (19 residues), see Phobius details TIGR00924: amino acid/peptide transporter (Peptide:H+ symporter)" amino acids 17 to 489 (473 residues), 327.7 bits, see alignment E=7.2e-102 PF07690: MFS_1" amino acids 33 to 438 (406 residues), 82.4 bits, see alignment E=3.1e-27 PF00854: PTR2" amino acids 89 to 440 (352 residues), 176.5 bits, see alignment E=8.4e-56

Best Hits

KEGG orthology group: K03305, proton-dependent oligopeptide transporter, POT family (inferred from 73% identity to fjo:Fjoh_1421)

Predicted SEED Role

"Di-/tripeptide transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2T5 at UniProt or InterPro

Protein Sequence (493 amino acids)

>CA265_RS06570 MFS transporter (Pedobacter sp. GW460-11-11-14-LB5)
MEKTVSIEDIQNFEGKYPKQLWHLSLVEMWERFCFYGMRGVLAFFMVEQLGLSDQKSNLQ
YGAIQAFVYAFTFIGGIFADKILGFRKSLFWGGALMIIGNLILAFSPHDLFYVGITLSII
GTGFFKPNVSSMVGELYHEKDNRRDAGYGLFYAGINVGGLLGGAMCIYLGKYYNWHLCFL
SAALVMMFGLGTFIFTKKHLGPIGNSPLLHLKKSKQQFLEIAVYVGSILCIPMIYIMVRN
TAFTDYFMYTIGIIALVYFLYETFKIKDQKAQYKLLAAFVFIFCYFIFMAISEQSGGSLS
LFAKDNLDHKILFFNIDPNVVNNSANSFFVIVFSPIVGILWLGLYKRKIEPNTVVKFGIG
FLLLALSFYVFYATRFFANVQGISSLNVFTLAYLLLTLGELCLGPIGMSIITKLSPKKMF
GMMMGLWFLSSAFGQLAAGKLGAEMSSIDDASLSAKLMAYTEGYKTLALYSLIAGLALIL
FSQLVKKLMQEVR