Protein Info for CA265_RS06565 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dolichyl-phosphate beta-D-mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00535: Glycos_transf_2
  • amino acids 6 to 171 (166 residues), 104 bits, E=9e-34
• PF10111: Glyco_tranf_2_2
  • amino acids 6 to 105 (100 residues), 27.6 bits, E=2e-10

Best Hits

KEGG orthology group: K00721, dolichol-phosphate mannosyltransferase [EC: 2.4.1.83] (inferred from 83% identity to psn:Pedsa_2229)

Predicted SEED Role

"Dolichol-phosphate mannosyltransferase"

MetaCyc Pathways

• protein O-mannosylation II (mammals, core M1 and core M2) (1/5 steps found)
• protein O-mannosylation III (mammals, core M3) (1/5 steps found)
• protein O-mannosylation I (yeast) (1/8 steps found)
• protein N-glycosylation (Haloferax volcanii) (1/11 steps found)
• protein N-glycosylation initial phase (eukaryotic) (1/19 steps found)

KEGG Metabolic Maps

• N-Glycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.83

Use Curated BLAST to search for 2.4.1.83

Sequence Analysis Tools

See A0A1X9Z2S0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>CA265_RS06565 dolichyl-phosphate beta-D-mannosyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MSDSLVIIPTYNEKENIEKIIRKVFSLTQPFHVLIIDDGSPDGTAEIVKSLQDEYEGHLF
IEERAGKQGLGTAYIYGFNWALQHDYAYIFEMDADFSHNPDDLSRLREACVNGADVAIGS
RYVKGVNVVNWPMGRVLMSYFASMYVRMITRINIQDATAGFKCYRKIVLETIPLNKIKFV
GYAFQIEMKFTAIKFGFKVVEVPIIFTDRTEGTSKMSTRIFREAFLGVIQMKVWSWFRNY
SRKAEVGSPKSGV