Protein Info for CA265_RS06320 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01476: LysM" amino acids 45 to 81 (37 residues), 22.5 bits, see alignment 4.5e-09 amino acids 106 to 148 (43 residues), 46.1 bits, see alignment 1.9e-16 amino acids 186 to 228 (43 residues), 49 bits, see alignment 2.3e-17 amino acids 259 to 301 (43 residues), 44.1 bits, see alignment 8.1e-16 amino acids 340 to 382 (43 residues), 40.6 bits, see alignment 1e-14

Best Hits

Predicted SEED Role

"possible LysM domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2E1 at UniProt or InterPro

Protein Sequence (512 amino acids)

>CA265_RS06320 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MHKIYLSAVVLFALNIANAKASTVRDSIGVENNKGKKLIVHQTVAKDTYYSIGRRYNVSP
KDIMSFNDNKYLQVGVIIKVPTNIPFTANGSSNATQNASSSNVIEHTIKPKENLNMLAEK
YGTTINEIKALNNLSGNNLSIGQVLKIPAKNTEQTGTSAPVTPPAKNNTETATANTSSAD
QTMIEHTVAPKEFLGKIAEKYGTTVEEVKKANNLSGNNLRIGQKLKIPATKNIDENKVVA
AAEEKPVQENKSADAAGTHTVLRNETIFTIAKQYGITAYQIRKLNDLPDNAITIGQVLKV
PGGIITDVQVPKEKQAEAKVKEVEAKVKEAPAAKEESFIHTVATGENIFTIAKKYNLTAY
QIRTANKLEDNAIKVDQKLIIPKPPQPKSVNDLSKEEQENEPDSTMVKDPKLRRDPSVYG
LSQIEEKGTAVWIADQDLDGTKMLVLHRTAPVGRVIKITNPMTNRTTFAKVVGKFTENES
TKDVIIVMTKAVADSLGALDKRFFCNLTYSAQ