Protein Info for CA265_RS06315 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: uridine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07693: KAP_NTPase
  • amino acids 3 to 207 (205 residues), 24.3 bits, E=1.8e-09
• PF00485: PRK
  • amino acids 7 to 183 (177 residues), 103.6 bits, E=1.2e-33

Best Hits

Swiss-Prot: 34% identical to URK_CLONN: Uridine kinase (udk) from Clostridium novyi (strain NT)

KEGG orthology group: K00876, uridine kinase [EC: 2.7.1.48] (inferred from 82% identity to phe:Phep_2916)

Predicted SEED Role

"Uridine kinase (EC 2.7.1.48)" (EC 2.7.1.48)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• pyrimidine ribonucleosides salvage I (3/3 steps found)
• nucleoside and nucleotide degradation (archaea) (4/10 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.48

Sequence Analysis Tools

See A0A1X9ZCF9 at UniProt or InterPro

Protein Sequence (214 amino acids)

>CA265_RS06315 uridine kinase (Pedobacter sp. GW460-11-11-14-LB5)
MNKKPFIIGIAGGSGSGKTFFLNCFLHHFKQDEVTLVSQDDYYIPAGEMTQEENKLYNFD
LPSTIDSEQFLRDIKQLMSGEVVYKKEYNFNNPLAVVKILEIKSAPIIIVEGLFILHFKE
IAALLDHTIFVDADEQVALDRRIKRDGLERGYPEEDVLYKWHNHVVPAYKEYLLPYREQC
NKVVMNNTNEPEEIIGITEDISNDLRNSILVDIQ