Protein Info for CA265_RS06210 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details amino acids 349 to 375 (27 residues), see Phobius details PF01790: LGT" amino acids 144 to 372 (229 residues), 124.2 bits, see alignment E=2.8e-40

Best Hits

KEGG orthology group: None (inferred from 76% identity to phe:Phep_2936)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.99.-

Use Curated BLAST to search for 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z217 at UniProt or InterPro

Protein Sequence (382 amino acids)

>CA265_RS06210 diacylglyceryl transferase (Pedobacter sp. GW460-11-11-14-LB5)
MFPTVSHFLEYLFGINLPLPFNTFGVFVALAFVAGYWAFTKELKRKEALGILHPIKKTIV
VGKPATTSELIMNGLFGFVIGYKLVYALLNYKLFVNDAQSILMSTKGNIIGGLFFAGLFA
YWDYTEKNKHKLDKPKETQVTIHPYQTMSNLIVWAAIWGFLGAKFFDNLEYWDDFVQHPI
ERLLSFSGLTFYGGLICGGAAVLIIAKRNGIKPLHMLDVGGPGMMLAYAVGRIGCHLAGD
GDWGIVNNNPKPFSWLPDWLWSYKYPNNVVGEGIPIPGCTGKFCNELAQGVYPTPIYEVI
ICLILFAFLWKIRDKIKAPGLMFGIYMILNGLERFCIELIRVNSKYHVFGLSFTQAEMIS
TFLVVGGIALSAYALRNKNQLA