Protein Info for CA265_RS06135 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: Na+/H+ antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 48 (20 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 83 to 105 (23 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 351 to 372 (22 residues), see Phobius details amino acids 385 to 408 (24 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 6 to 410 (405 residues), 240.1 bits, see alignment E=1.9e-75 TIGR00831: Na+/H+ antiporter" amino acids 7 to 415 (409 residues), 316.2 bits, see alignment E=1.9e-98

Best Hits

KEGG orthology group: None (inferred from 74% identity to cpi:Cpin_4062)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2K7 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CA265_RS06135 Na+/H+ antiporter (Pedobacter sp. GW460-11-11-14-LB5)
MENYAIVIFILAVMIGLSAIADRIKIPYPILLIIAGIAVGFVPSLPPIDINPEIIFLIFL
PPLLYDAAFNISFKEFKTNINTIFALAITLVFITAIGIAVVAHYMIPGMSWPVSFVLGAI
LSATDAVAAMSITKGLGLSHKTNTILEGESLVNDASALVAYRFAVAAVTGTAFVFWKASL
EFALLMAGGFLIGVVMSRILAFIIKRIHNNRLATISFMLLMPFVTYLIAEQVHVSGVIAV
VILGLGISRFSNKVFPEQLKNQSKNIWDIIIFLLNGLIFILIGLQFPYVYKNINSTDILP
YIAYSLVITIVALLLRMARVFLQKFNLQKAFQKGKHRITEDALLDFKNSLIISWSGMRGI
VSLAIAIGLPATLSDGSAFPQRNAIIFISVVVVLFTLIGQGLTLPWLVKKLATEED