Protein Info for CA265_RS05870 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sulfatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 646 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details PF00884: Sulfatase" amino acids 282 to 550 (269 residues), 162.4 bits, see alignment E=1.6e-51

Best Hits

Predicted SEED Role

"Sulfatase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z2I0 at UniProt or InterPro

Protein Sequence (646 amino acids)

>CA265_RS05870 sulfatase (Pedobacter sp. GW460-11-11-14-LB5)
MSIKEKTNKLLEHRFGPVFLVTILLSAISLITRLSLLIYSAANVDWSIINLLKILVIGLF
YDLAAASFAVIPLVIYLWLLPSKWYTSKFNKVLLFIYFFFAVFTLIFNAISEWFFWEEFS
VRYNFIAVDYLVYTTEVIGNIRQSYPINIIMVGLVIITILILYFLRKFITASTINKTSFG
KRTKIALVLLCLPVLTYFGVSHKWKYHSKNQYVNELSGNGMYDFGFAFWNNQLDYNTFYK
TLPIKNAETILSRLLQQDSAAKGEFKYTSRTINNPGTENKMNVVLISVESLSAEFLGTFG
NTQHITPQLDSLAKEGLSFSNLYASGTRTVRGLEALSLCIPPTPGQSIVKRPDNQNLFTL
GSIFRSKGYNARFIYGGYGYFDNMNEFFSNNGYEVTDRSALQDSEIHYSNIWGVADEDLF
MLSLRELDKDYKNKKPFFAQIMTVSNHRPYTYPEGRIDIPSHSGREGAVKYTDYAIGKFI
REAKQKPWFSNTLFVIVADHCASSAGKVELPVDKYHIPMIFYSPGHIKPGKFDKLTAQID
IGPSILGYLNFSYDSKFFGQDVFKMKAGDERAFISTYQSLGYLKNNKLVILNPNKKATTY
KPDFTTGGAVAIPADEKLTHEAIANYQMASYLYQNGLYGFESKKKP