Protein Info for CA265_RS05625 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 34 to 59 (26 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 363 to 382 (20 residues), see Phobius details amino acids 394 to 411 (18 residues), see Phobius details amino acids 424 to 450 (27 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 111 to 423 (313 residues), 156.7 bits, see alignment E=3.5e-50

Best Hits

KEGG orthology group: None (inferred from 48% identity to phe:Phep_2085)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z207 at UniProt or InterPro

Protein Sequence (456 amino acids)

>CA265_RS05625 sulfate transporter (Pedobacter sp. GW460-11-11-14-LB5)
MSNRNNAADTTRALTDAGISPDKKTFLQALTEDWWAVILGTIIIATVLYLTSNGTVISLP
AFKWANSEDLLGKILSASNLLLIVETGVVFMALASIAIGLSGGNVARFAGGFALIYFLAI
VSFIIGGNKSVSYFGLEYVVFALLIGIALGNLIKLPSWLKEAVRSEFYIKTGLVILGTTI
LSADLIKAGLPGIIQAIIVVTVVWFFSMWLSRKLKVDDEFGVILASAVSICGVSAAIVAA
GAINGDKRKLSYVTTLVLIMAIPMMIILPWAVKYFHIPEVIGGAWLGGTLDTTATVTAAG
DLVGPIAVKAGVIAKFSQNVFIGVAAFFIAIWWAYKKPKGEDGVVIKAERPGLKIVWERF
PKFVLGFVAASLVFSFLLSPATAKSVAPTLNGLRTVWFAIAFISIGMEAKFSSLVKLQGG
KPAFTFVTAQIFNIFWTLLWSYILFGGYVFPVPDFK