Protein Info for CA265_RS05510 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: guanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 74 (26 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 163 to 335 (173 residues), 48.5 bits, see alignment E=4.2e-17

Best Hits

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC98 at UniProt or InterPro

Protein Sequence (342 amino acids)

>CA265_RS05510 guanylate cyclase (Pedobacter sp. GW460-11-11-14-LB5)
MNRQTQQKLQQLFIIILAWMMTGVVIAVFEDLVLHTRNSLGPVPGYTLVSSILLNAVIGL
FGALLGGSLLVFFVNVKYNDKPYGYTLLIVAGSFLCVILIVNELLSLYELGDSKRFLKNG
LVWAIVVSITQLLLQINSKFGQGIFWDIIRGKYNTPKEESRIFMFLDLNSSTSIAESLGD
KKYHELLKDIFIDITNPILENRGEIYQYVGDEVVIAWRYDEGLRNNKCINCFFDIKAHLL
LLRNKYHEKYGLLPAFKAGIHCGKVIAGEVGIIKRDITYSGDVLNTTSRIQNMCKEFNQE
MLVSIALAEELQLTDHYTTQLLGAIKLRGKEKEMQLVAVQPV