Protein Info for CA265_RS05255 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 TIGR00229: PAS domain S-box protein" amino acids 33 to 146 (114 residues), 38.3 bits, see alignment E=6.7e-14 PF13426: PAS_9" amino acids 41 to 128 (88 residues), 26.7 bits, see alignment E=1.1e-09 PF08447: PAS_3" amino acids 52 to 135 (84 residues), 52.6 bits, see alignment E=9.2e-18 PF00512: HisKA" amino acids 148 to 212 (65 residues), 62.7 bits, see alignment E=5.5e-21 PF02518: HATPase_c" amino acids 255 to 364 (110 residues), 98.2 bits, see alignment E=8e-32

Best Hits

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z283 at UniProt or InterPro

Protein Sequence (506 amino acids)

>CA265_RS05255 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MISESSLGINDDFEKDLNEEKDIDLEEPSSALLLNAIPQQVWTANSAGEINYVNDVICRD
FGHSPKTILAQGWTSFVHQDDLLSSIQRWKASLESGKEYTNEFRLLFSDGLYYWHLVIAR
LVKQKGKPDIWVGTNTNIHTQKMNEARKDEFISIASHELKTPLTTIKGFHQLLLRIAEEG
KVKSYLERSSGQLNRLEKLIGDLLDVSKINAGKMLLNSELFDFSSMLKEVVVEMRQMYPK
HELKLAIQDETAFNGDRFRLEQVIHNFVSNAVKYSPDSKTVEINAKIADGNIIVSVTDYG
IGIKSSDLEQLFERYYRVDNSSTRFDGLGLGLYISADIIKRHGGSFWIESTLGKGSVFSF
KLPLISNYLVSPEIHTKSHYKDKHITISCPADSDTMHVEWTGHQDMHSVKHGGTLMIEYL
RANQRSKVFNDNRLVPGTWSEASDWAANIWLPLMELAGLKFFAWILSESAFSQLSAKKSV
ENDDKQAEIVFFTYAEEGLKWLADKK