Protein Info for CA265_RS05210 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: tRNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF01596: Methyltransf_3" amino acids 11 to 107 (97 residues), 26 bits, see alignment E=2.7e-09 PF05175: MTS" amino acids 25 to 157 (133 residues), 67.9 bits, see alignment E=4.3e-22 PF13489: Methyltransf_23" amino acids 29 to 110 (82 residues), 30.5 bits, see alignment E=1.4e-10 PF06325: PrmA" amino acids 32 to 110 (79 residues), 36.8 bits, see alignment E=1.6e-12 PF13847: Methyltransf_31" amino acids 35 to 122 (88 residues), 42.7 bits, see alignment E=2.5e-14 PF13649: Methyltransf_25" amino acids 39 to 113 (75 residues), 41.3 bits, see alignment E=1e-13 PF08242: Methyltransf_12" amino acids 40 to 110 (71 residues), 32.8 bits, see alignment E=4.9e-11 PF08241: Methyltransf_11" amino acids 40 to 110 (71 residues), 25.8 bits, see alignment E=6.6e-09 PF01170: UPF0020" amino acids 58 to 114 (57 residues), 24.2 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 59% identical to TRMN6_PEDHD: tRNA1(Val) (adenine(37)-N6)-methyltransferase (Phep_2972) from Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)

KEGG orthology group: None (inferred from 59% identity to phe:Phep_2972)

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1P3 at UniProt or InterPro

Protein Sequence (233 amino acids)

>CA265_RS05210 tRNA methyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MSIFKFKQFEVDQKGCAMRINTDGVLIAAMANQEEPKNILDIGTGTGVIALMLAQRFPDA
NIHAVEIDEQAAGTAKRNFQSSVFSDRLSISNVAIEQFSHSAKFDLIVSNPPFFVNDLKS
EESRKGIARHADEDFFRLLIEKSNSLLADGGLIWLILPIKQANEVISSAADYGLFLAERI
HIHSDQSKPTFRQVICLKRGEIVSKERDFNIYESLKQHTIVYKELLKDFFLAF