Protein Info for CA265_RS05155 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 2 to 461 (460 residues), 572.6 bits, see alignment E=3e-176 PF07992: Pyr_redox_2" amino acids 3 to 323 (321 residues), 227.3 bits, see alignment E=1.5e-70 PF01134: GIDA" amino acids 4 to 143 (140 residues), 23.9 bits, see alignment E=1.2e-08 PF12831: FAD_oxidored" amino acids 4 to 142 (139 residues), 32.4 bits, see alignment E=3.8e-11 PF00890: FAD_binding_2" amino acids 4 to 43 (40 residues), 27.8 bits, see alignment 8.3e-10 PF13738: Pyr_redox_3" amino acids 6 to 307 (302 residues), 44.8 bits, see alignment E=5.6e-15 PF00070: Pyr_redox" amino acids 173 to 252 (80 residues), 73.7 bits, see alignment E=7.8e-24 PF02852: Pyr_redox_dim" amino acids 343 to 452 (110 residues), 127.4 bits, see alignment E=1.6e-40

Best Hits

Swiss-Prot: 50% identical to DLDH_CHLTE: Dihydrolipoyl dehydrogenase (lpd) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 92% identity to phe:Phep_3001)

MetaCyc: 41% identical to glycine cleavage system L protein 1 (Arabidopsis thaliana col)
GCVMULTI-RXN [EC: 1.4.1.27]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of branched-chain alpha-keto acid dehydrogenase (EC 1.8.1.4) / Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle or Isoleucine degradation or Valine degradation (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1N5 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CA265_RS05155 dihydrolipoyl dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MNYDVIVLGSGPGGYVAAIRASQLGLKVAIVERESLGGICLNWGCIPTKALLKSAQVFEY
INHAADYGITTAGATADFAAVVKRSRGVADGMSKGVQFLMKKNKIDVIMGTGKVKPGNKL
EVKGADGSQQELSAKNIIIATGARSRELPNLKQDGKKIIGYRQAMVLPELPKSMVVVGSG
AIGVEFAYFYATMGTKVTIVEFMDNVVPVEDEDVSKQLLRSLKKVGIDVMTSASVESVDT
SGAGCKVSVKTASGMQTIEADIVLSAAGIVANIENIGLEETGIKTEKGKIVTDEFYNTSV
KGYYAIGDVVGGQALAHVASAEGIICVEKIAGQHAEPLDYNNIPGCTYCTPEIASVGYTE
KAAKAAGYELKIGKFPFSASGKASAAGAKDGFVKLIFDAKYGELLGAHMIGANVTEMIAE
IVVARKLETTGHEMIKSVHPHPTMSEAIMEAAADAYGEVIHL