Protein Info for CA265_RS04800 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 196 to 218 (23 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 293 to 322 (30 residues), see Phobius details PF01594: AI-2E_transport" amino acids 12 to 328 (317 residues), 171 bits, see alignment E=2e-54

Best Hits

KEGG orthology group: None (inferred from 62% identity to dfe:Dfer_0136)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z213 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CA265_RS04800 AI-2E family transporter (Pedobacter sp. GW460-11-11-14-LB5)
MLKTYPFYIKAPVILLGIVITVFMMSVLRDILVPLAFAALIAILLNPLTNRFERKMPKIV
SIMLAMIIGIVVVVAILYFLSSQVAHFFDDLDSIKHKLSQLLEEIRAWLQTTFGISSQKQ
MQMVNDAANGSKALIGQTLSGLMGVLSVVFLIPVYTFLILLYKTLILNFIYEVFSEENKQ
KVAEILGETKAAIQSYIIGLLIETSIVAVMNSAALLILGVQNAILIGVIGAILNLLPYIG
GIIAIALPVLMATLTMDGFTTQLLIIGAYALIQFIDNNILVPRIVSSKVQINALISIVIV
LMGAALWGIPGMFLSIPFIAVLKIIFDRIDGLKPWGKLLGDNIPTEHMGQVKRFRRKKTV
ATGK