Protein Info for CA265_RS04370 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA protecting protein DprA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 340 to 358 (19 residues), see Phobius details PF14520: HHH_5" amino acids 8 to 55 (48 residues), 39.4 bits, see alignment 1.7e-13 PF12826: HHH_2" amino acids 12 to 56 (45 residues), 27.5 bits, see alignment 7e-10 PF00633: HHH" amino acids 30 to 56 (27 residues), 27.4 bits, see alignment (E = 5.4e-10) TIGR00732: DNA protecting protein DprA" amino acids 70 to 284 (215 residues), 227.7 bits, see alignment E=5e-72 PF02481: DNA_processg_A" amino acids 71 to 274 (204 residues), 247.8 bits, see alignment E=1.6e-77 PF17782: DprA_WH" amino acids 305 to 359 (55 residues), 38.1 bits, see alignment 3.2e-13

Best Hits

KEGG orthology group: K04096, DNA processing protein (inferred from 64% identity to phe:Phep_1433)

Predicted SEED Role

"Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1X9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CA265_RS04370 DNA protecting protein DprA (Pedobacter sp. GW460-11-11-14-LB5)
MSMLHKIALTFIKTIGPVTAKNLLAYCGSAENVFSASKKQLLQIPGIGEKTIEAIRGSDA
LVRARQELDFIEKHGIEVLFFSDEKYPKRLKNCIDSPILLYAKGTADFNQQRIISIVGTR
NATSYGKNLCKELCEVLAPYNVLIVSGLAYGIDVTAHKECLANNIPTVGVLGHGLDRMYP
KIHKTVAQKMVSNGGLLTEFPILTNPDRQNFPQRNRIIAGIADATVVVEASIKGGALITA
EIANSYNKDVYAFPGRTNDVFSEGCNFLIKTNRAGLINNANDLIYYLGWDDEVKGKHPIQ
QTRLQLNLTPNEQRVVDALQNGQLSIDELCAQLNIQQSKLAIVILTLEMQGIIVSLPGKI
YKLL