Protein Info for CA265_RS04320 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 30 to 49 (20 residues), see Phobius details amino acids 60 to 88 (29 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 262 to 288 (27 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 372 to 391 (20 residues), see Phobius details amino acids 402 to 421 (20 residues), see Phobius details PF13687: DUF4153" amino acids 62 to 456 (395 residues), 161.3 bits, see alignment E=2e-51

Best Hits

KEGG orthology group: None (inferred from 51% identity to phe:Phep_3016)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1X0 at UniProt or InterPro

Protein Sequence (522 amino acids)

>CA265_RS04320 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MENKSNLLTLSVLLGGLLFTFLFWQERLALNLLIYSIYLLAITFINPDVVKSNKLKIYGL
AHLLAAVLVVVNNSDLAVATYYISLLLFIGFSHNQQIRTIFTAFLASILQMITVPFNAIR
HLSKVSIGNFNLKPVFKLIKYIFIPVIAVIFFACLYSAANNVFAHYAESVLTSIGQFFED
ILHFFFKDLSIGRIVHFCFGLVLTGGLLLAFFDKSLEKAELKCKEQLVRIRKTIGQKTIW
YNIVETFSGNLLTRKMALKTEYIVGIISFVALNLLLLLLNAIDITTLWFGYKPSGNFSGE
LHQGTNTLIFSIVMAMAIILYFFRGNLNFYHKSQTLRVLAFTWMAQNFILIISVLIRDSY
YIEFHGLTHKRIGVLVFAILCIIGLATVYFKVAKQKTIFYLFKVNGNIWFALLLTFSTIN
WDVFIVKYNLAHSTSIALDADYLLSLSEKTLPTLDKSRNKLVMPPSFIPEEETVVSADKN
NDQILTRLDKRIGYFKSRYEESGWLSWNLQDSNTAAYFGLNK