Protein Info for CA265_RS04165 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sigma-54-dependent Fis family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00072: Response_reg" amino acids 6 to 120 (115 residues), 63.9 bits, see alignment E=5.2e-21 PF00158: Sigma54_activat" amino acids 154 to 320 (167 residues), 213 bits, see alignment E=7.9e-67 PF14532: Sigma54_activ_2" amino acids 155 to 325 (171 residues), 67.6 bits, see alignment E=4.8e-22 PF07728: AAA_5" amino acids 177 to 298 (122 residues), 25.6 bits, see alignment E=3.9e-09 PF02954: HTH_8" amino acids 414 to 454 (41 residues), 50.8 bits, see alignment 3.8e-17

Best Hits

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_3412)

Predicted SEED Role

"Two-component system response regulator" in subsystem Streptococcal Mga Regulon or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z113 at UniProt or InterPro

Protein Sequence (456 amino acids)

>CA265_RS04165 sigma-54-dependent Fis family transcriptional regulator (Pedobacter sp. GW460-11-11-14-LB5)
MLDATVLIIDDDDDILLSARLFLKQQVKQVITCKSPKEINVLLSKNEIDIILLDMNYQKG
ASDGREGLYWLEHILSIDKDYVVILMTAFGNVELAVKAIKKGATDFILKPWENEKLFATI
SSASKLRESTKKVKKLEKIHSSLQKDLTRGFENIVGQADEIKQLQNTLLKVAPTDANVLI
LGENGTGKQVFAYEIHGNSQRKNQVFMHVDLGSLNENLFESELFGYAKGAFTDAKEDKPG
RFELADGGTIFLDEIGNLTLPLQAKLLSVLQNRTVTRLGESKERKVNVRLITATNMPLNE
MVAKNTFRQDLLFRINTVELLLPALRKRGTDILLLANHFMQVFSAKYHKDIRKLSNKAQQ
ALLQYKWPGNVRELQHVLERAVIMSDGADIAEEDLQLSPQRYAQNNTIPDEMALEDMEKM
MVQKAIDKHKGNISKAAAELGLTRAALYRRIEKFGI