Protein Info for CA265_RS04120 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: sulfate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00009: GTP_EFTU
  • amino acids 2 to 200 (199 residues), 152.1 bits, E=2e-48
• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 4 to 410 (407 residues), 542.4 bits, E=7.3e-167
• TIGR00231: small GTP-binding protein domain
  • amino acids 8 to 188 (181 residues), 45.1 bits, E=9.6e-16

Best Hits

Swiss-Prot: 52% identical to CYSN_PSYIN: Sulfate adenylyltransferase subunit 1 (cysN) from Psychromonas ingrahamii (strain 37)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 79% identity to phe:Phep_3087)

MetaCyc: 49% identical to sulfate adenylyltransferase subunit 1 (Escherichia coli K-12 substr. MG1655)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction IV (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction II (2/3 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

See A0A1X9Z188 at UniProt or InterPro

Protein Sequence (416 amino acids)

>CA265_RS04120 sulfate adenylyltransferase (Pedobacter sp. GW460-11-11-14-LB5)
MNILKFFTAGSVDDGKSTLIGRLLYDTDSILADQLEALQSSNRKNDDGTIDLAILTDGLR
AEREQGITIDVAYKYFQTEKRKFIIADTPGHIQYTRNMVTGASTANLAIILIDARNGVVE
QTIRHSYIVSLLGIKHVVVCINKMDMVDYSETVYSAIIEKYKVLAQQLKLADVTYIPVSA
LKGDNIVQNSGNMDWYEGESLLHFLEKVDTDNLDKSQLARMPVQWVVRPQTEELHDYRGY
AGRVLSGTFNLNDKVTVLPSGASSTVEKIEFFDQTPDAAHAGQSVIIHLKDDVDISRGDT
IVNASALPQESKLIEADLCWMDGRALDTSIMYNIQHNSKITRCKISEILHKVDINTLEKH
AADEFKLNDIGRVIIKTADALAFDLYDDNRANGSAILVDTRTNLTVGALMFRAAVE