Protein Info for CA265_RS04105 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: siroheme synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 transmembrane" amino acids 220 to 238 (19 residues), see Phobius details amino acids 254 to 278 (25 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details amino acids 352 to 374 (23 residues), see Phobius details amino acids 386 to 413 (28 residues), see Phobius details amino acids 426 to 445 (20 residues), see Phobius details amino acids 452 to 468 (17 residues), see Phobius details amino acids 478 to 500 (23 residues), see Phobius details TIGR01470: siroheme synthase, N-terminal domain" amino acids 24 to 193 (170 residues), 114.7 bits, see alignment E=2.2e-37 PF13241: NAD_binding_7" amino acids 26 to 138 (113 residues), 79.2 bits, see alignment E=4.9e-26 PF14824: Sirohm_synth_M" amino acids 143 to 166 (24 residues), 35.3 bits, see alignment (E = 9.5e-13) PF01925: TauE" amino acids 259 to 493 (235 residues), 121.2 bits, see alignment E=8.9e-39

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 67% identity to shg:Sph21_3192)

Predicted SEED Role

"Siroheme synthase / Precorrin-2 oxidase (EC 1.3.1.76) / Sirohydrochlorin ferrochelatase (EC 4.99.1.4)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.1.76, EC 4.99.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.76 or 4.99.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z155 at UniProt or InterPro

Protein Sequence (503 amino acids)

>CA265_RS04105 siroheme synthase (Pedobacter sp. GW460-11-11-14-LB5)
MQVLPNQPNNAESFSEEEKGNQLFPVFVKLNKLRTLLIGAGNIGLEKLTAIVNNSQQATI
TIVAELISPEVYALIANYPLIKVKQKSFDVDDLNDIDIVFAATNNNILNEEIRKVTHERG
LLINVADKPELCDFYLGSIVQKGDLKIAISTNGKSPTIAKRLKQILNEGLPAELDETLQN
MSALRQTLNGDFSAKVKKLNKVTQSLINPKKSFAERNIKWLIWVASVLLIGAIGFSLWNT
EPEFQAFLINIDPLFYWFLGAGFVFALIDGAIGMSYGVTTASFSLAMGLPPASASMAIHI
SEVMSNGIAGWMHYRMGNVNWKLFKILIIPAIIGAVLGAYILSSLEHYSAYVKPVVAVYT
LVLGAIILMKAFNIKRKKAQDKIKKIGLLGFVGGFIDAAFGGGWGSIVLSSLIAGGRHPL
FSLGTVKISRFFIATLSSLTFFTMLGGKHWEAVLGLIIGSAIASPIAAKVSNKISAKTIM
VAVGIIVMIVSLRSVIMFILKLI