Protein Info for CA265_RS03855 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: TldD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01523: PmbA_TldD_1st" amino acids 62 to 126 (65 residues), 53.5 bits, see alignment E=3.2e-18 PF19289: PmbA_TldD_3rd" amino acids 289 to 537 (249 residues), 103.2 bits, see alignment E=1.7e-33

Best Hits

KEGG orthology group: K03568, TldD protein (inferred from 73% identity to sli:Slin_1332)

Predicted SEED Role

"TldD family protein, Actinobacterial subgroup" in subsystem Putative TldE-TldD proteolytic complex

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z167 at UniProt or InterPro

Protein Sequence (544 amino acids)

>CA265_RS03855 TldD protein (Pedobacter sp. GW460-11-11-14-LB5)
MKRKDFLYLSGMGMGALLLPDLSAFGTPIDPLQALDGVDVKIKKELADVALNAAKSKGAT
YADIRIGRYLNQFVATREKRVQGVANTESYGVGIRVLANGCWGFAATNNVTKDAIAKAAE
QAVAVAKANAKIQGEPVQLAPQKGYGEVSWKTPIEINAFEVPVKEKVDLLLNVNDVAMQN
GANFVNSVIFAVNEQKYFASTDGSYIDQDVHRIYPTFNVTKVDRESGKFKTRNALSAPSG
KGYEYMHARPEDKVTGIVTRYKGRYDMLEDVKEAARVATEKVKAKSVEPGKYDLVLDPSH
LWLTIHESVGHPTELDRVLGYEANYAGTSFLTLDKWESKKFKFGSDKVNIVADKTQVGSL
GAVGYDDEGVKCKKWDLIKNGVLTSYQAIRDQAHIIGLTESNGCCYSQGWDDVQFQRMPN
VSLQPGKEKLSVDDMIKNVEKGIYIIGDGSFSIDQQRYNFQFGGQIFYEIKEGKIAGMLN
DVAYQANTQEFWNSCNAICDESDYRLGGSFNDGKGQPSQSSAVSHGSATTRFNGVNVINT
ARKI