Protein Info for CA265_RS03635 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 125 to 147 (23 residues), see Phobius details PF00815: Histidinol_dh" amino acids 20 to 424 (405 residues), 562 bits, see alignment E=4.2e-173 TIGR00069: histidinol dehydrogenase" amino acids 32 to 423 (392 residues), 527.4 bits, see alignment E=1.3e-162

Best Hits

Swiss-Prot: 54% identical to HISX_BACFR: Histidinol dehydrogenase (hisD) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 72% identity to phe:Phep_3192)

MetaCyc: 50% identical to histidinal/histidinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Histidinol dehydrogenase. [EC: 1.1.1.23]

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1A5 at UniProt or InterPro

Protein Sequence (426 amino acids)

>CA265_RS03635 histidinol dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MKIYNYTDLSKSKIEELCSRQIEDDKLVEERVTDIISTVKKDGDQALFNFAKAFDKVDLE
KLFLDAEELKSIASNIPAEAKKAIDTAYQNIKTFHQSQLKTEDKIETMPGVMCWRESRPI
EKVGLYIPGGTAVLPSTFLMLATPAIIAGCKEIVVCSPPQNDGKTNCYLAYCAVLLGIEK
VFLIGGAQAVAAMAFGTESVPQVYKIFGPGNRYVTTAKTMVQNKVAIDMPAGPSEVLVIA
DETANPSFIAADLLAQAEHGTDSQAILVATSYQIIAETLKEIENQLNVLPRKDIAAKAIA
NSYAVLAKNLEEAMQFSNEYAPEHLILATEHFQSLIPLITNAGSVFLGNLTPESAGDYAS
GTNHTLPTSGFAKAYSGVSTDAFLKKITFQHLSATGLNNIGRTVEILAAAEGLEAHKNAV
SIRLKN