Protein Info for CA265_RS03630 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: histidinol-phosphate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01141: histidinol-phosphate transaminase
  • amino acids 8 to 345 (338 residues), 378.5 bits, E=1.3e-117
• PF01053: Cys_Met_Meta_PP
  • amino acids 38 to 183 (146 residues), 32.7 bits, E=4.8e-12
• PF00155: Aminotran_1_2
  • amino acids 46 to 342 (297 residues), 221.1 bits, E=3.8e-69
• PF00266: Aminotran_5
  • amino acids 115 to 180 (66 residues), 25.5 bits, E=9.9e-10

Best Hits

Swiss-Prot: 57% identical to HIS8_CYTH3: Histidinol-phosphate aminotransferase (hisC) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 78% identity to phe:Phep_3193)

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• L-histidine biosynthesis (10/10 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• L-phenylalanine biosynthesis I (3/3 steps found)
• L-tyrosine biosynthesis I (3/3 steps found)
• L-tyrosine degradation I (4/5 steps found)
• 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
• L-tyrosine degradation II (1/2 steps found)
• atromentin biosynthesis (1/2 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-phenylalanine degradation II (anaerobic) (1/3 steps found)
• L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
• superpathway of plastoquinol biosynthesis (2/5 steps found)
• 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
• L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
• L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
• L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
• (S)-reticuline biosynthesis I (3/11 steps found)
• rosmarinic acid biosynthesis I (1/10 steps found)
• superpathway of chorismate metabolism (35/59 steps found)
• superpathway of rosmarinic acid biosynthesis (1/14 steps found)
• anaerobic aromatic compound degradation (Thauera aromatica) (1/27 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of phenylpropanoids
• Histidine metabolism
• Novobiocin biosynthesis
• Phenylalanine metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

See A0A1X9Z1F0 at UniProt or InterPro

Protein Sequence (346 amino acids)

>CA265_RS03630 histidinol-phosphate transaminase (Pedobacter sp. GW460-11-11-14-LB5)
MDINDLVRENIKNLRPYSTARDEFKGQASVFLDANENSYGSPLPANYNRYPDPLQLDLKD
AISKIKGVPIENTFLGNGSDEAIDLLFRAFCNPGKDNVIVLPPTYGMYEVSANINDVEIR
KVSLLPNFQLDMEKIAETIDKNTKLIFICSPNNPTGNSINREDIETILANFNGIVVVDEA
YINYARQKTFIQELTEYGNLVVLQTFSKAWGLAALRLGMAFSSTKVIDVLNKIKPPYNIN
QATQDLAFEALKNIAQVNDWIKESVAERDRLSKALTALNIVKKVYPSDANFILTEVTDAL
KIYDTLVDQGIIVRDRSKVTLCEGCLRITVGTKEENDKLLTVLENF