Protein Info for CA265_RS03615 in Pedobacter sp. GW460-11-11-14-LB5

Updated annotation (from data): 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR00007.
Original annotation: 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00007: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
  • amino acids 3 to 237 (235 residues), 229.8 bits, E=1.7e-72
• PF00977: His_biosynth
  • amino acids 3 to 234 (232 residues), 220.4 bits, E=2.2e-69

Best Hits

Swiss-Prot: 38% identical to HIS4_BACV8: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 85% identity to phe:Phep_3196)

MetaCyc: 36% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

See A0A1X9Z0Z5 at UniProt or InterPro

Protein Sequence (249 amino acids)

>CA265_RS03615 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Pedobacter sp. GW460-11-11-14-LB5)
MYIIPAIDILDGKVVRLREGDYNQKTEYAVSIPEMIEKYRSNGTDFIHIIDLNGAKGDFS
NQKTLFEIIKKTEMKVQYGGGIRTIEQVTNLLDAGIHRVIVGTQAITNPDFLPQLSEAFA
KKDDYANRIVIAIDVLDEVIKYSGWMESSPIKLMDYVDKCLSLGFFRFLCTDISKDGKLG
GAAIDLYEKLLEHSPMIKLIASGGVSSMQDIYDLAKYPIRSVVVGKAIYEDRITIEEIKE
WNLKALSSI