Protein Info for CA265_RS03610 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: imidazole glycerol phosphate synthase subunit HisF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF04480: DUF559" amino acids 11 to 115 (105 residues), 112.9 bits, see alignment E=1.4e-36 TIGR00735: imidazoleglycerol phosphate synthase, cyclase subunit" amino acids 130 to 378 (249 residues), 348 bits, see alignment E=1.4e-108 PF00977: His_biosynth" amino acids 133 to 361 (229 residues), 268 bits, see alignment E=1.3e-83 PF01207: Dus" amino acids 159 to 243 (85 residues), 27.3 bits, see alignment E=4.1e-10

Best Hits

Predicted SEED Role

"Imidazole glycerol phosphate synthase cyclase subunit (EC 4.1.3.-)" in subsystem Histidine Biosynthesis (EC 4.1.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0S2 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CA265_RS03610 imidazole glycerol phosphate synthase subunit HisF (Pedobacter sp. GW460-11-11-14-LB5)
MFYGASHIIFENAKRLRNKVTEAENLLWQVISNKQLGVKFRRQHPISYFIADFYCHEAKL
IIELDGSIHDLPEVLNNDIERQKALEQFGIRVIRFKNAELYNNLDSVLEKIKEAIQAKQF
ASPPLGGGGLSKRIIPCLDVKDGRTVKGVNFVDLRDAGDPVELAAQYAQQGADELVFLDI
TATHERRKTMIEMVKSVARQLNIPFTIGGGITEIADAEALLNAGADKISINSAAVRNPKL
IEDLAKTFGVQFVVLAVDTKYVDGKNMVHLNGGRLITELETENWIKQAEDLGAGEILLTS
MDHDGTKAGFDCGLLSKVNQMINIPIIASGGAGNMAHFTEVFQKANVDAALAASVFHYGE
ILIPDLKQELKRNNIPVRI