Protein Info for CA265_RS03300 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: DNA polymerase III subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00712: DNA_pol3_beta" amino acids 1 to 120 (120 residues), 79.8 bits, see alignment E=2.8e-26 TIGR00663: DNA polymerase III, beta subunit" amino acids 1 to 368 (368 residues), 277.4 bits, see alignment E=8.6e-87 PF02767: DNA_pol3_beta_2" amino acids 130 to 243 (114 residues), 68.2 bits, see alignment E=1.2e-22 PF02768: DNA_pol3_beta_3" amino acids 247 to 363 (117 residues), 84.3 bits, see alignment E=9.4e-28

Best Hits

KEGG orthology group: K02338, DNA polymerase III subunit beta [EC: 2.7.7.7] (inferred from 95% identity to phe:Phep_3235)

Predicted SEED Role

"DNA polymerase III beta subunit (EC 2.7.7.7)" in subsystem DNA-replication (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0K8 at UniProt or InterPro

Protein Sequence (374 amino acids)

>CA265_RS03300 DNA polymerase III subunit beta (Pedobacter sp. GW460-11-11-14-LB5)
MRFIVSTSTLLKHLQTVNGASSSSTVLPILENFLFEIKDGNLTISATDLQTSMTTALAVE
SKEEGKVAVPSKILLDTLKTLPDQPIAFNIDDSTFAIEISAGDGKYKLSGENGDDFPKIP
VVENASSVNLPASVLTEAITKTIFAVSNDELRPAMTGVFCQLSPQHITFVATDAHKLVRY
RRMDSKADKATSFILPKKALTLLKAALPSTDINVSVDYNATSAFFKFENINLVCRLIDER
YPDYEAVIPTNNPNKLIIDRSLFLNTLRRVVIFANKTTHQVRLKISGSELNISSEDLDFA
NEAHERLSCQYDGEDLEIGFNARFLIEMLSNLSGDEVTLELSTPNRAGLLIPQTNDENED
VLMLVMPVMLNNSY