Protein Info for CA265_RS03290 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gliding motility-associated ABC transporter permease subunit GldF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details TIGR03518: gliding motility-associated ABC transporter permease protein GldF" amino acids 1 to 237 (237 residues), 315.3 bits, see alignment E=1.8e-98 PF12730: ABC2_membrane_4" amino acids 16 to 171 (156 residues), 32.9 bits, see alignment E=1.3e-11 PF12698: ABC2_membrane_3" amino acids 51 to 230 (180 residues), 43.7 bits, see alignment E=4.3e-15 PF13346: ABC2_membrane_5" amino acids 53 to 197 (145 residues), 29.2 bits, see alignment E=1.4e-10 PF12679: ABC2_membrane_2" amino acids 59 to 232 (174 residues), 46.6 bits, see alignment E=5.9e-16

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 70% identity to phe:Phep_3237)

Predicted SEED Role

"gliding motility protein GldF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z1C8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>CA265_RS03290 gliding motility-associated ABC transporter permease subunit GldF (Pedobacter sp. GW460-11-11-14-LB5)
MYAVFKRELFSFLSSMVAYITIGIFLLVSGLLLWFFPDTSILDYGYAELDGFFSLVPYLF
MFLIPAVTMRSFAEERREGTYELLITRPIQIWQIIFAKYLASLVLVLFALIPTSIYYYSI
SKLGFPEGNIDSGSVIGSYIGLFLLGAAFTSIGIFSSALTKNQVIAFVISAALCAFAFLG
FDYSSQLAAFQSIGNMISSLGINQHYTSISRGVLDTRDLIYFITFSVLFLLVTKIIIGGK
R