Protein Info for CA265_RS03120 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: disulfide bond formation protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 PF13462: Thioredoxin_4" amino acids 10 to 160 (151 residues), 97.6 bits, see alignment E=1.4e-31 PF01323: DSBA" amino acids 23 to 159 (137 residues), 64.5 bits, see alignment E=1.7e-21 PF13743: Thioredoxin_5" amino acids 69 to 155 (87 residues), 28.6 bits, see alignment E=1.8e-10

Best Hits

KEGG orthology group: None (inferred from 56% identity to phe:Phep_0529)

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z143 at UniProt or InterPro

Protein Sequence (172 amino acids)

>CA265_RS03120 disulfide bond formation protein DsbA (Pedobacter sp. GW460-11-11-14-LB5)
MSTLKPEINNQDHVQGDDSASVTIVEFGDYQCPYCGNAYPIMKEIEETFGHQIRFIFRHF
PLANAHEFAFPGAIAAEAAGLQGKFWEMHDALYENQYRLDGELFDELAETIGLDLELFQQ
DSTSEEIKRKIEDDFDSGVRSGVNGTPSFYVNGTKFDGGATDLYQMLKESAE