Protein Info for CA265_RS03045 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details PF01062: Bestrophin" amino acids 12 to 281 (270 residues), 180.6 bits, see alignment E=2.3e-57

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 63% identity to phe:Phep_3670)

Predicted SEED Role

"protein of unknown function UPF0187"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0H5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>CA265_RS03045 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MLLRNNIPLTYIFGKIKKELLFVIGYSIGIVVLYENFHVTRISIPVAVPALLGTIISLLL
AFRSNQAYDRWWEARILWGAIVNDSRTLSRQILSFVENPYGLDEVEQFKERFIKRQIAWC
YALSKSLRGFNARKDLEEYLCAEEIAFIKKRKNVTTTILELHAMDLKKALQEGWINKYQQ
IEIDKTITALCNHMGGSERIKNTVFPVTYSKYINMSIHLFIVLLPFGLIEYFGYMEVPLV
VAIAAFFLLVEKMAVHLQDPFENKPTDTPTTTICRNIERDLCQMLDDNKIYEDKPQTELA
PVGSYYIL