Protein Info for CA265_RS02840 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: 30S ribosomal protein S30

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 115 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 102 (102 residues), 54.7 bits, see alignment E=5.8e-19 PF02482: Ribosomal_S30AE" amino acids 4 to 96 (93 residues), 73.4 bits, see alignment E=1e-24

Best Hits

Swiss-Prot: 31% identical to HPF_ECOLI: Ribosome hibernation promoting factor (hpf) from Escherichia coli (strain K12)

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 89% identity to phe:Phep_0841)

Predicted SEED Role

"Ribosome hibernation protein YhbH" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z144 at UniProt or InterPro

Protein Sequence (115 amino acids)

>CA265_RS02840 30S ribosomal protein S30 (Pedobacter sp. GW460-11-11-14-LB5)
MKIGVQSIHFSADSKLLDFIQKKANKLDQFFDQIISGEVYLKLENVEDEANKISEIKLIV
PGGTLFAKEQCKSFEEATDLAIESLRKQITKHKDKTRAKLSEHKAILSESEAADY