Protein Info for CA265_RS02830 in Pedobacter sp. GW460-11-11-14-LB5
Annotation: 30S ribosomal protein S21
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to RS21_PARD8: 30S ribosomal protein S21 (rpsU) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
KEGG orthology group: K02970, small subunit ribosomal protein S21 (inferred from 87% identity to phe:Phep_0839)Predicted SEED Role
"SSU ribosomal protein S21p" in subsystem Macromolecular synthesis operon or Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1X9ZC86 at UniProt or InterPro
Protein Sequence (64 amino acids)
>CA265_RS02830 30S ribosomal protein S21 (Pedobacter sp. GW460-11-11-14-LB5) MIIINIKDGESLDKALKRFKKKFEKTGVLRELRSRQAYEKKSVARRTEIKHAVYIQNMNQ DTTA