Protein Info for CA265_RS02820 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF02771: Acyl-CoA_dh_N" amino acids 10 to 122 (113 residues), 135.6 bits, see alignment E=2e-43 PF02770: Acyl-CoA_dh_M" amino acids 127 to 221 (95 residues), 86.6 bits, see alignment E=2.1e-28 PF00441: Acyl-CoA_dh_1" amino acids 233 to 381 (149 residues), 179.8 bits, see alignment E=7.7e-57 PF08028: Acyl-CoA_dh_2" amino acids 248 to 365 (118 residues), 89.9 bits, see alignment E=3.4e-29

Best Hits

Swiss-Prot: 52% identical to ACDA_BACSU: Acyl-CoA dehydrogenase (acdA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 87% identity to phe:Phep_0837)

MetaCyc: 48% identical to Bcd (Clostridium acetobutylicum ATCC 824)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0Z1 at UniProt or InterPro

Protein Sequence (384 amino acids)

>CA265_RS02820 acyl-CoA dehydrogenase (Pedobacter sp. GW460-11-11-14-LB5)
MSVSFDFSETETQQSVKAMVRDFAEKNIRPHIMEWDEAQHFPVELFKQLGELGLMGVLVP
EEYGGSGLGYQEYVDVIVEVARVCGSIGLSLAAHNSLCTGHILAFANPEQKQRWLPKLAT
AEWIGAWGLTEANTGSDALRMMTTAVEDGDDYIINGAKNWITHGKSGDIAVVMVRTGEQG
SSKGISAIVVERGTPGFTAGKKENKLGMRASETTEMIFDNCRVPKANLLGNVGEGFKQAM
KVLDGGRISIAALALGIAKGAFDAAVAYSKQRQQFGQPISSFQAISFKLADMATEIEAAE
LLIRQAADLKNRHLPMTKESAMAKYFASEVSVRVATDAVQIFGGYGYTKDFPVEKFYRDS
KLCTIGEGTSEIQKIVIAREVLQG