Protein Info for CA265_RS02625 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: rhamnose/proton symporter RhaT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 35 to 57 (23 residues), see Phobius details amino acids 69 to 90 (22 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 238 to 258 (21 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 310 to 327 (18 residues), see Phobius details amino acids 339 to 359 (21 residues), see Phobius details PF06379: RhaT" amino acids 4 to 359 (356 residues), 228.8 bits, see alignment E=5.8e-72

Best Hits

KEGG orthology group: K02856, L-rhamnose-H+ transport protein (inferred from 76% identity to dfe:Dfer_4532)

Predicted SEED Role

"L-rhamnose-proton symporter" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0S0 at UniProt or InterPro

Protein Sequence (364 amino acids)

>CA265_RS02625 rhamnose/proton symporter RhaT (Pedobacter sp. GW460-11-11-14-LB5)
MQAILGVIFHFFGGFASGSFYIPYKKVKGWAWESYWIVGGIFSWLIVPPLAAFLTIPNFT
AIITSTNGSILWLTYFFGVLWGIGGLTYGLGVRYLGVSLGSSIILGLCMVLGSILPSIYF
DFFPQAGKDTFTMFLHTDWGRMVLLGLLVCVVGIIICGKAGMMKEKEMKTGITDPHGMEV
KTEYKFGLGLFVGIVSGVLSACFNFGIEAGKPMADAANAIWKAANPAEPGNFLFQNNVTY
VIVLWGGLTTNFIWCMVLNARNKTFGDYTNAAKPLLKNYIFSALAGTTWFLQFFFYGMGE
SKMGNGASSWILHMAFIILIANVWGLVLKEWKGVSRKTLITVLAGILTIIISVLIVGYGN
RIKG