Protein Info for CA265_RS02455 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 208 to 208 (1 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details PF13237: Fer4_10" amino acids 296 to 376 (81 residues), 42.3 bits, see alignment E=2.9e-14 PF12800: Fer4_4" amino acids 298 to 312 (15 residues), 15.4 bits, see alignment (E = 9.9e-06) amino acids 364 to 377 (14 residues), 14.7 bits, see alignment (E = 1.7e-05) PF13484: Fer4_16" amino acids 299 to 378 (80 residues), 33.8 bits, see alignment E=2.4e-11 PF13187: Fer4_9" amino acids 300 to 378 (79 residues), 44.1 bits, see alignment E=8.6e-15 PF13534: Fer4_17" amino acids 300 to 380 (81 residues), 25.2 bits, see alignment E=1e-08 PF13183: Fer4_8" amino acids 343 to 379 (37 residues), 27.5 bits, see alignment 1.9e-09

Best Hits

KEGG orthology group: None (inferred from 80% identity to phe:Phep_0747)

Predicted SEED Role

"Iron-sulphur-binding reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0X3 at UniProt or InterPro

Protein Sequence (431 amino acids)

>CA265_RS02455 Fe-S oxidoreductase (Pedobacter sp. GW460-11-11-14-LB5)
MVAQILFLVLTLAAIALFTVNLRKIIRNIRLGKPVDRQDQPQKRLMTMLRVAFGQSKMVV
RPIPAFLHFFVYIGFVIINIEVLEIIIDGLFGTHRIFNGLGGLYNFLIGSFEILAFTVWV
SCAIFLVRRNILKLKRFSGVEMKSWPKSDANYILITEILLMSAFLLMNAADAKLQLLGAS
HYVNAGAFPVSQYLINILPSSESALVVIERSCWWFHIIGILAFLNYLPYSKHFHILFAFP
NTYFSNLEPKGEFTNMASVTNEVKAMLDPSFVPAETEPGKFGAKDVTDLSWVNLMNAYTC
TECGRCTSVCPANITGKLLSPRKIMMDTRDRITEVGQNIDKHGAEHQDGKSLLDDYISRE
EIWACTSCNACVEACPVNIDPLQIITELRRFAVMEESQAPGSINAMMGNIENNQAPWKYS
PADRFNWAQES