Protein Info for CA265_RS02335 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12796: Ank_2
  • amino acids 6 to 98 (93 residues), 64.4 bits, E=3.4e-21
  • amino acids 105 to 195 (91 residues), 59.4 bits, E=1.3e-19
  • amino acids 171 to 261 (91 residues), 54.4 bits, E=4.6e-18
  • amino acids 298 to 362 (65 residues), 57.3 bits, E=5.8e-19
• PF13637: Ank_4
  • amino acids 7 to 55 (49 residues), 33.3 bits, 1.4e-11
  • amino acids 42 to 88 (47 residues), 23.9 bits, 1.3e-08
  • amino acids 136 to 185 (50 residues), 36.4 bits, 1.5e-12
  • amino acids 305 to 354 (50 residues), 56.6 bits, 6.9e-19
• PF13857: Ank_5
  • amino acids 20 to 72 (53 residues), 35.4 bits, 3.3e-12
  • amino acids 120 to 174 (55 residues), 29.8 bits, 1.9e-10
  • amino acids 295 to 340 (46 residues), 34.7 bits, 5.6e-12
  • amino acids 322 to 373 (52 residues), 27.4 bits, 1.1e-09
• PF00023: Ank
  • amino acids 35 to 65 (31 residues), 31 bits, see alignment (E = 6.2e-11)
  • amino acids 136 to 165 (30 residues), 24.2 bits, see alignment (E = 9.6e-09)
  • amino acids 166 to 197 (32 residues), 19.9 bits, see alignment (E = 2.1e-07)
  • amino acids 232 to 261 (30 residues), 22.1 bits, see alignment (E = 4.2e-08)
  • amino acids 301 to 331 (31 residues), 29.1 bits, see alignment (E = 2.5e-10)
  • amino acids 334 to 364 (31 residues), 29.1 bits, see alignment (E = 2.6e-10)
• PF13606: Ank_3
  • amino acids 35 to 61 (27 residues), 21.9 bits, see alignment (E = 5.1e-08)
  • amino acids 135 to 162 (28 residues), 19.9 bits, see alignment (E = 2.2e-07)
  • amino acids 232 to 260 (29 residues), 21.2 bits, see alignment (E = 8.6e-08)
  • amino acids 301 to 329 (29 residues), 22.8 bits, see alignment (E = 2.6e-08)
  • amino acids 334 to 360 (27 residues), 22.3 bits, see alignment (E = 3.8e-08)
• PF09851: SHOCT
  • amino acids 422 to 448 (27 residues), 29.9 bits, see alignment (E = 1e-10)

Best Hits

KEGG orthology group: None (inferred from 65% identity to fjo:Fjoh_0898)

Predicted SEED Role

No annotation

Sequence Analysis Tools

See A0A1X9Z005 at UniProt or InterPro

Protein Sequence (450 amino acids)

>CA265_RS02335 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MSMSFIIACESGKRKIAELLLANQEVEVGYTDEKGRTALHYAAHRGYLDLVQILIDRGAA
LDYEDHAGETPFYFACLQKQKQTALFLLDKGARVDIKDFKGNSLLHLTAQSGQIEVLEKL
IDQGLEVDGENNEAETPLLIAASWRNKEVVQKLLEFGANINTTNKHGDSPLIFAVKSKNT
PMVELILDKGGNINHVNHAGESALLIACYDANRMLTKILVEKGADVFVSSKDGLSPIWYA
CANNQKEIVDLFLSHGVDVNYAKPLSGKDDSMYSYLEWVETANNISISASFSFDNNYNYG
GESMLHVAAKSGHLSMLKLLTEKGANVNIQDESGNTALHYSAANGKKDAVKFLLEKSADP
TIVNVKEQKAIDYSNIKGFNEITELLLQFGPSNISNQPIKGAAPAENSAEPAKNDITSKK
QALLDLKELLDAGILSQEEFDAEKTKILKG