Protein Info for CA265_RS02250 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: ribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 30 to 54 (25 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 216 to 236 (21 residues), see Phobius details amino acids 248 to 273 (26 residues), see Phobius details PF03631: Virul_fac_BrkB" amino acids 25 to 280 (256 residues), 129.9 bits, see alignment E=7.1e-42

Best Hits

KEGG orthology group: None (inferred from 65% identity to phe:Phep_3282)

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z0J3 at UniProt or InterPro

Protein Sequence (307 amino acids)

>CA265_RS02250 ribonuclease (Pedobacter sp. GW460-11-11-14-LB5)
MPSITEDLKFFFSTIRKAFNLFQQNDPLRLAGATAFFTNFALPPILIILIRLFGMFTDRR
LLATHLFERLASILDNESILQIRTTLRNIRGIDQAWYVTLFSFIFFLFVATTLFNVIKNS
LEQIWNIGQKDKKGIINTLKSRAISVTIILLAGILFFIGLLADSVQAYIGAYLKNGAPSF
GLVLTSIINQFVFVLIVTTWFTILFRYLTNGRPTWRAAISGGLLTGCLFTAGKYILRILL
PLSNISNIYGSAGSIIVIMLFVFYSSLIFYFGASFIKALSVGRATPIIPKNGSFAYELTE
VELEKEE