Protein Info for CA265_RS02215 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: acetyl-CoA carboxylase biotin carboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00514: acetyl-CoA carboxylase, biotin carboxylase subunit
  • amino acids 11 to 453 (443 residues), 648.2 bits, E=3.4e-199
• PF00289: Biotin_carb_N
  • amino acids 11 to 119 (109 residues), 151.5 bits, E=2.9e-48
• PF02786: CPSase_L_D2
  • amino acids 125 to 331 (207 residues), 268.3 bits, E=1.1e-83
• PF02222: ATP-grasp
  • amino acids 146 to 301 (156 residues), 35.1 bits, E=2.7e-12
• PF07478: Dala_Dala_lig_C
  • amino acids 153 to 300 (148 residues), 43.8 bits, E=5.5e-15
• PF02785: Biotin_carb_C
  • amino acids 345 to 450 (106 residues), 134.7 bits, E=3.4e-43

Best Hits

Swiss-Prot: 56% identical to PYCA_METJA: Pyruvate carboxylase subunit A (pycA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 86% identity to phe:Phep_3289)

MetaCyc: 54% identical to pyruvate carboxylase subunit A (Methanothermobacter thermautotrophicus Delta H)
Pyruvate carboxylase. [EC: 6.4.1.1]

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

• gluconeogenesis III (9/12 steps found)
• L-leucine degradation I (4/6 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Citrate cycle (TCA cycle)
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.1 or 6.4.1.4

Sequence Analysis Tools

See A0A1X9ZCV8 at UniProt or InterPro

Protein Sequence (503 amino acids)

>CA265_RS02215 acetyl-CoA carboxylase biotin carboxylase subunit (Pedobacter sp. GW460-11-11-14-LB5)
MPENSKAQTPISKLLVANRGEIALRIMRSAKEMGIKTVAVFSEADRNALHVRYADEAVCI
GPAPSNQSYLVGEKIIGACKLTGAEAIHPGYGFLSENAGFAQMVADAGLILVGPSPQAME
TMGNKLSAKAAALKYNIPMVPGTEEAIQDVNEAKQRAIEVGFPILIKAAAGGGGKGMRIV
ERAEDFEEQMQLAVSEATSAFGDGAVFIERYVTSPRHIEIQVLGDNHGNIVHLFERECSV
QRRHQKVIEEAPSSVLTEEIRQRMGKCAVDVARSVNYTGAGTVEFILDENLDFFFLEMNT
RLQVEHPVTELITGIDLVKEQLKIASGEKLSFSQEDLKISGHAVELRVYAEDPANNFLPD
IGTLQTYNTPKGNGVRVDDGFEQGMEIPIYYDPMIAKLITYGKDREEAIERMVRAIEEYD
ITGIETTLGFGKFVMQHEAFKTGNFDTHFVGKYFKPESLKVQDETEALIAAVIAAKLFDK
KEVKLGDAAIKNSSDWRKNRLKY