Protein Info for CA265_RS02160 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01345: DUF11" amino acids 106 to 221 (116 residues), 81 bits, see alignment E=8.7e-27 TIGR01451: conserved repeat domain" amino acids 122 to 160 (39 residues), 31 bits, see alignment 1.7e-11 PF13585: CHU_C" amino acids 229 to 311 (83 residues), 85.6 bits, see alignment E=2.1e-28 TIGR04131: gliding motility-associated C-terminal domain" amino acids 230 to 313 (84 residues), 42.2 bits, see alignment E=6.9e-15

Best Hits

KEGG orthology group: None (inferred from 49% identity to phe:Phep_1646)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z015 at UniProt or InterPro

Protein Sequence (313 amino acids)

>CA265_RS02160 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MMMFNRFGIIVFGMLLLSAVACFAQSSNPNTLNLKPGVTVKLRANGTGATSYQWFRNGEA
ILGATSQDYVVNAAGKYTVITFSLGGCSSDLSEEMEVVMETAMSADVSIVKRSESRQVIN
TEVFKYNLLVRNNGLGNATNIQVKDDLPENLTFVSVDPTIVGTASYNEQTKTVSWAIPTL
ANGSFVELVVNVRAMKPGNVVNSASVTINEADPDPSNNISVDTKEITGLKIPNVFTPNGD
GKNETFFIERLDRYSENQLTVINRWGSTVYEKDSYLNDWTANGLVDGTYFYVLKVKTTSA
QWQEFKGYVTVIR