Protein Info for CA265_RS01855 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 70 to 86 (17 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 120 to 123 (4 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 207 to 227 (21 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details PF00953: Glycos_transf_4" amino acids 73 to 226 (154 residues), 128.5 bits, see alignment E=1.2e-41

Best Hits

KEGG orthology group: None (inferred from 35% identity to mtt:Ftrac_2655)

Predicted SEED Role

"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.-

Use Curated BLAST to search for 2.7.8.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZC57 at UniProt or InterPro

Protein Sequence (345 amino acids)

>CA265_RS01855 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MAIFILAFSIVVISIPSVIYTSLKYGLFDKNDLHRKNHKRNISRLGGLAIVGSFTVSILL
FSAIINFKEANFLIASCIILSALGLKDDVYGTNTSTKFILQIVVAFILVFFGAFRLTSLY
GVLGIGDMLPLWGSLFSIALIIFLNNAFNLIDGIDGLAGGIGILTSLVFGILFSSMGQIA
YAFIAFALAGAIAGFLKYNWFPAKIFMGDTGALIIGLISAALAIKFIELNKFTGGSKPAF
YSAPAIAVAILIVPVFDSLRVFTIRILKGGSPFKGDRNHIHHRLEQLGLKPSWIVISTAG
FNLATIAATIILQHLGNFVLILLIIGLCIAFNSLLTLSLLKKKGR