Protein Info for CA265_RS01815 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF02357: NusG" amino acids 7 to 98 (92 residues), 66.9 bits, see alignment E=1.9e-22

Best Hits

KEGG orthology group: None (inferred from 54% identity to phe:Phep_3892)

Predicted SEED Role

"Transcriptional activator RfaH" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZU1 at UniProt or InterPro

Protein Sequence (167 amino acids)

>CA265_RS01815 antitermination protein NusG (Pedobacter sp. GW460-11-11-14-LB5)
MIDQNYRWYPVYTRSRAEKKANEELNRKGIQTYLPLKKAVKQWSDRKKIVEEPLIKSYLF
AYISAREYAEVLMTNGVARFIYFSSQIASIPDQQIHDLKLLLATDADLELIDYDIKPGER
VLIKAGPFKGVIAELVSVHNKQRIILRLQNMGYSININTSIAFVEPI