Protein Info for CA265_RS01765 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF03848: TehB" amino acids 28 to 135 (108 residues), 23.4 bits, see alignment E=1.1e-08 PF13489: Methyltransf_23" amino acids 30 to 227 (198 residues), 43.5 bits, see alignment E=8.4e-15 PF13847: Methyltransf_31" amino acids 41 to 142 (102 residues), 50.7 bits, see alignment E=5.4e-17 PF13649: Methyltransf_25" amino acids 43 to 135 (93 residues), 50.3 bits, see alignment E=1e-16 PF08242: Methyltransf_12" amino acids 44 to 137 (94 residues), 36.5 bits, see alignment E=2e-12 PF08241: Methyltransf_11" amino acids 45 to 139 (95 residues), 45.3 bits, see alignment E=3.3e-15

Best Hits

KEGG orthology group: None (inferred from 40% identity to din:Selin_2472)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZT1 at UniProt or InterPro

Protein Sequence (251 amino acids)

>CA265_RS01765 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MTIQNFKLYSQYYDLLYQDKDYFAETAYIVNLIKKYRPESSKIIELGSGTGKHASLLAKK
GYTILGIERSEQMIEIANKTKTENVDFQIGDIVKFKTNQSFDIALSIFHVISYLTNNKDL
IKTFLNVHQSLNLNGLFIFDVWHSPAVNFQVPEKRTKRLENAEIRITRKANPTILYEENV
VEVNYDIKVEDLKTNKEINIKEIHPMRHFSKQEIELLAYATGFQILHSEEFLTSAPASNH
TWGVCYILRKL