Protein Info for CA265_RS01665 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 191 (17 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 224 to 256 (33 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 26 to 314 (289 residues), 66.1 bits, see alignment E=1.5e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZR1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>CA265_RS01665 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MALLPKRKWKLILNSVTKSQIPYLNAVQTLRGFAACLVLLHHIWMFYPKIPFLYLAMQKM
YLGVEVFFVISGFIIPYSMFAAGYELKNIGLFLWKRILRIDPPYLVMIAITLIINFSLNR
SNVISFNNLLLHVAYLIPFTHEKWISSVFWTLAIEFQYYLIIAFIFPLLIHKNRWVILFT
ISAILSLNLISHSMDFLPRWVTYFVMGIVTFYFKINKINRNEYIIAILALGILLKFQIST
MFALVGIMSAFYLAFASFLNRITDFFGKISYSLYISHWSFLPLISYFLVKSIGINPNFHV
ILFLLSFMICIIIAYIFYLFIEKYFAEKSKKISYHKKAKMLTDPNYASY