Protein Info for CA265_RS01565 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: circadian clock protein KaiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF07689: KaiB" amino acids 21 to 101 (81 residues), 75.4 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 47% identical to KABL1_SYNY3: KaiB-like protein 1 (sll1596) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 53% identity to sli:Slin_1882)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9ZD16 at UniProt or InterPro

Protein Sequence (104 amino acids)

>CA265_RS01565 circadian clock protein KaiB (Pedobacter sp. GW460-11-11-14-LB5)
MSTGNPDHPDSTPSAEFFSLRLFIAGASPVSARAIVNIRAICEEFIAGRYELDIIDAHQQ
PLLVQHEDVTAIPMLIKKSPLPTRKLIGDCSDREKVLKGLGIRY