Protein Info for CA265_RS01275 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 7 to 31 (25 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 300 to 318 (19 residues), see Phobius details amino acids 329 to 349 (21 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 4 to 453 (450 residues), 342.7 bits, see alignment E=1.7e-106 PF00083: Sugar_tr" amino acids 14 to 457 (444 residues), 371.7 bits, see alignment E=5.9e-115 PF07690: MFS_1" amino acids 18 to 396 (379 residues), 119.6 bits, see alignment E=1.5e-38

Best Hits

KEGG orthology group: None (inferred from 40% identity to aac:Aaci_2900)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9Z032 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CA265_RS01275 hypothetical protein (Pedobacter sp. GW460-11-11-14-LB5)
MRKQGANYFIFLITLIAALGGFLFGFDMAVVSGIIEPLKSQYGLSSAQEGLFVSCALLGC
IVGVSFSGYLSDKVGRRKVLFLAAILFLVSAVGFAFSVAYPVLIFFRVLAGMGVGVASNV
SPLYISEVAPSQKRGRLVVFYQLAITIGILAAYISNLFLQRYATVHAGAGEGILHWLFVE
NVWRGMFIVGVVPAAAFCLLLLIVPESPRWLVQYGRNEEALNTLIKINGAETGRLELDSI
KEMASQKSGGYKELMRLPLSKLLALATILTALSQFSGINGVIFYGPTILKSAGIVTSDAL
FYQVILGSANVLFTFIAISKVDTWGRRPLYIIGSLCAAGALALTGFCFLMDITGWFMLFS
IILFLLFFAFSLGPLKFVISTEIFPTHIRGTALSMCIMTMWVSDWVVNMLFPIMRDGLGI
ATTFFIFSFFCILSFLYAKKKLFETKGKSLEEIEKAWNSEVK