Protein Info for CA265_RS01125 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: gluconate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 98 to 127 (30 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 329 to 358 (30 residues), see Phobius details amino acids 369 to 392 (24 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details PF02447: GntP_permease" amino acids 1 to 426 (426 residues), 461 bits, see alignment E=4e-142 TIGR00791: transporter, gluconate:H+ symporter (GntP) family" amino acids 1 to 429 (429 residues), 463.8 bits, see alignment E=3.2e-143 PF03553: Na_H_antiporter" amino acids 159 to 347 (189 residues), 25 bits, see alignment E=1.1e-09

Best Hits

Predicted SEED Role

"Gluconate permease, Bsu4004 homolog" in subsystem D-gluconate and ketogluconates metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZL9 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CA265_RS01125 gluconate permease (Pedobacter sp. GW460-11-11-14-LB5)
MSLFILLFGILLLFVLILKKINPMIALIAVAIITGLLLGMPATKVMASISNGIGSTLGSM
VMVLALGAMMGKLIEDSGSAKKIVFILIGAFGKKNIQWAVLLTGLLVGIPLFYNAGFVVL
IPLVFAISATTGLSKLYIGIPMATALSVTHGFLPPHPGPVALAGIFHADIGKTLIYGLTL
SVPIAVIAGIYFPRLILKRDQSVTVQHFSISEEENLPSASRSFITALLPVFLIIAGTIGS
SFKIDYICKPLFIFLADPTAALLISVIIALVVQKTSITKAMESCAEGVKSIAMIILIIAA
GGAFKQILIDSGMGETVKQLTGGLNLSPLLLAWLITASLRVTLGSATVAALTASGMVLPL
IGPGTPPELMVLSVGAGSLMFSHVNDTGFWMFKEYFNLSLKETFRTWTMMESLVSVLGLV
GVLVLNQFV