Protein Info for CA265_RS00265 in Pedobacter sp. GW460-11-11-14-LB5

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 198 to 216 (19 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 46 to 202 (157 residues), 91.4 bits, see alignment E=4.9e-30 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 46 to 202 (157 residues), 172.5 bits, see alignment E=8.5e-55 PF04542: Sigma70_r2" amino acids 50 to 115 (66 residues), 34.7 bits, see alignment E=1.8e-12 PF08281: Sigma70_r4_2" amino acids 148 to 196 (49 residues), 57.1 bits, see alignment 1.6e-19 PF04545: Sigma70_r4" amino acids 151 to 199 (49 residues), 36.6 bits, see alignment 3.9e-13

Best Hits

KEGG orthology group: None (inferred from 71% identity to phe:Phep_1932)

Predicted SEED Role

"RNA polymerase, sigma-24 subunit, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YZ39 at UniProt or InterPro

Protein Sequence (221 amino acids)

>CA265_RS00265 RNA polymerase sigma-70 factor (Pedobacter sp. GW460-11-11-14-LB5)
MLSFHPSVIPLFKIQKLINIYLTTIKPVELTAVASGITDQYHDDAAFEHLFKTHYHALHA
YAQVILKDEDVAEEIVQGMFLKFWEKRESLKIQSIKAYLYKCVYNDSLNYIKQEKTKSKY
QEFTVHSMNTEHEPAAAKVEFTELQQHLRDALNHLPEQCRTIFQMSRFEELKYREIADHL
GLSIKTVENQMGKALRILRLKLADFLVFILLGLWYYNDFFN